Anti SLC35B1 pAb (ATL-HPA048655)

Atlas Antibodies

SKU: ATL-HPA048655-25

• 

Protein Description: solute carrier family 35, member B1
Gene Name: SLC35B1
Alternative Gene Name: UGTREL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020873: 100%, ENSRNOG00000004510: 100%
Entrez Gene ID: 10237
Uniprot ID: P78383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
• Gene Sequence: QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
• Gene ID - Mouse: ENSMUSG00000020873
• Gene ID - Rat: ENSRNOG00000004510
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.