Anti SLC34A2 pAb (ATL-HPA066474)

Atlas Antibodies

SKU: ATL-HPA066474-25

• 

Protein Description: solute carrier family 34 member 2
Gene Name: SLC34A2
Alternative Gene Name: NAPI-3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029188: 59%, ENSRNOG00000004626: 61%
Entrez Gene ID: 10568
Uniprot ID: O95436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP
• Gene Sequence: APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP
• Gene ID - Mouse: ENSMUSG00000029188
• Gene ID - Rat: ENSRNOG00000004626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.