Anti SLC34A1 pAb (ATL-HPA077175)

Atlas Antibodies

SKU: ATL-HPA077175-25

• 

Product Description

Protein Description: solute carrier family 34 member 1
Gene Name: SLC34A1
Alternative Gene Name: NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021490: 79%, ENSRNOG00000015262: 77%
Entrez Gene ID: 6569
Uniprot ID: Q06495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP
• Gene Sequence: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP
• Gene ID - Mouse: ENSMUSG00000021490
• Gene ID - Rat: ENSRNOG00000015262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links