Protein Description: solute carrier family 34 member 1
Gene Name: SLC34A1
Alternative Gene Name: NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021490: 79%, ENSRNOG00000015262: 77%
Entrez Gene ID: 6569
Uniprot ID: Q06495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC34A1
Alternative Gene Name: NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021490: 79%, ENSRNOG00000015262: 77%
Entrez Gene ID: 6569
Uniprot ID: Q06495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP |
Documents & Links for Anti SLC34A1 pAb (ATL-HPA077175) | |
Datasheet | Anti SLC34A1 pAb (ATL-HPA077175) Datasheet (External Link) |
Vendor Page | Anti SLC34A1 pAb (ATL-HPA077175) at Atlas |
Documents & Links for Anti SLC34A1 pAb (ATL-HPA077175) | |
Datasheet | Anti SLC34A1 pAb (ATL-HPA077175) Datasheet (External Link) |
Vendor Page | Anti SLC34A1 pAb (ATL-HPA077175) |