Protein Description: solute carrier family 2 member 5
Gene Name: SLC2A5
Alternative Gene Name: GLUT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028976: 70%, ENSRNOG00000017693: 73%
Entrez Gene ID: 6518
Uniprot ID: P22732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC2A5
Alternative Gene Name: GLUT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028976: 70%, ENSRNOG00000017693: 73%
Entrez Gene ID: 6518
Uniprot ID: P22732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ |
| Documents & Links for Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) | |
| Datasheet | Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) | |
| Datasheet | Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) |