Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA075145-25

• 

Product Description

Protein Description: solute carrier family 2 member 5
Gene Name: SLC2A5
Alternative Gene Name: GLUT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028976: 70%, ENSRNOG00000017693: 73%
Entrez Gene ID: 6518
Uniprot ID: P22732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ
• Gene Sequence: VPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ
• Gene ID - Mouse: ENSMUSG00000028976
• Gene ID - Rat: ENSRNOG00000017693
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links