Anti SLC29A3 pAb (ATL-HPA046085)

Atlas Antibodies

SKU: ATL-HPA046085-25

• 

Protein Description: solute carrier family 29 (equilibrative nucleoside transporter), member 3
Gene Name: SLC29A3
Alternative Gene Name: ENT3, FLJ11160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020100: 64%, ENSRNOG00000000568: 62%
Entrez Gene ID: 55315
Uniprot ID: Q9BZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT
• Gene Sequence: YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT
• Gene ID - Mouse: ENSMUSG00000020100
• Gene ID - Rat: ENSRNOG00000000568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.