Anti SLC28A2 pAb (ATL-HPA055623 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055623-25

• 

Protein Description: solute carrier family 28 (concentrative nucleoside transporter), member 2
Gene Name: SLC28A2
Alternative Gene Name: CNT2, HCNT2, HsT17153, SPNT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027219: 72%, ENSRNOG00000028668: 74%
Entrez Gene ID: 9153
Uniprot ID: O43868
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
• Gene Sequence: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
• Gene ID - Mouse: ENSMUSG00000027219
• Gene ID - Rat: ENSRNOG00000028668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.