Anti SLC26A6 pAb (ATL-HPA048363 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048363-25
  • Immunohistochemical staining of human rectum shows moderate membranous positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and SLC26A6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403342).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 26 (anion exchanger), member 6
Gene Name: SLC26A6
Alternative Gene Name: DKFZp586E1422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107138: 60%, ENSRNOG00000020450: 59%
Entrez Gene ID: 65010
Uniprot ID: Q9BXS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS
Gene Sequence ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS
Gene ID - Mouse ENSMUSG00000107138
Gene ID - Rat ENSRNOG00000020450
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC26A6 pAb (ATL-HPA048363 w/enhanced validation)
Datasheet Anti SLC26A6 pAb (ATL-HPA048363 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC26A6 pAb (ATL-HPA048363 w/enhanced validation)