Protein Description: solute carrier family 25, member 27
Gene Name: SLC25A27
Alternative Gene Name: FLJ33552, UCP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023912: 89%, ENSRNOG00000010592: 86%
Entrez Gene ID: 9481
Uniprot ID: O95847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A27
Alternative Gene Name: FLJ33552, UCP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023912: 89%, ENSRNOG00000010592: 86%
Entrez Gene ID: 9481
Uniprot ID: O95847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL |
Documents & Links for Anti SLC25A27 pAb (ATL-HPA069732) | |
Datasheet | Anti SLC25A27 pAb (ATL-HPA069732) Datasheet (External Link) |
Vendor Page | Anti SLC25A27 pAb (ATL-HPA069732) at Atlas |
Documents & Links for Anti SLC25A27 pAb (ATL-HPA069732) | |
Datasheet | Anti SLC25A27 pAb (ATL-HPA069732) Datasheet (External Link) |
Vendor Page | Anti SLC25A27 pAb (ATL-HPA069732) |