Anti SLC25A23 pAb (ATL-HPA050883)

Atlas Antibodies

SKU: ATL-HPA050883-25

• 
• 

Protein Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
Gene Name: SLC25A23
Alternative Gene Name: APC2, FLJ30339, MGC2615
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046329: 85%, ENSRNOG00000047781: 83%
Entrez Gene ID: 79085
Uniprot ID: Q9BV35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
• Gene Sequence: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
• Gene ID - Mouse: ENSMUSG00000046329
• Gene ID - Rat: ENSRNOG00000047781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.