Anti SLC24A3 pAb (ATL-HPA045497)

Atlas Antibodies

SKU: ATL-HPA045497-25

• 

Protein Description: solute carrier family 24 (sodium/potassium/calcium exchanger), member 3
Gene Name: SLC24A3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063873: 100%, ENSRNOG00000060687: 100%
Entrez Gene ID: 57419
Uniprot ID: Q9HC58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSF
• Gene Sequence: CIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSF
• Gene ID - Mouse: ENSMUSG00000063873
• Gene ID - Rat: ENSRNOG00000060687
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.