Anti SLC1A7 pAb (ATL-HPA049124)

Atlas Antibodies

SKU: ATL-HPA049124-25

• 

Protein Description: solute carrier family 1 (glutamate transporter), member 7
Gene Name: SLC1A7
Alternative Gene Name: EAAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008932: 87%, ENSRNOG00000011644: 89%
Entrez Gene ID: 6512
Uniprot ID: O00341
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGM
• Gene Sequence: NLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGM
• Gene ID - Mouse: ENSMUSG00000008932
• Gene ID - Rat: ENSRNOG00000011644
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.