Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006877-25
  • Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA006877 antibody. Corresponding SLC18A1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 18 (vesicular monoamine transporter), member 1
Gene Name: SLC18A1
Alternative Gene Name: CGAT, VAT1, VMAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036330: 64%, ENSRNOG00000011992: 65%
Entrez Gene ID: 6570
Uniprot ID: P54219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI
Gene Sequence PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI
Gene ID - Mouse ENSMUSG00000036330
Gene ID - Rat ENSRNOG00000011992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation)
Datasheet Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation)