Protein Description: solute carrier family 18 (vesicular monoamine transporter), member 1
Gene Name: SLC18A1
Alternative Gene Name: CGAT, VAT1, VMAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036330: 64%, ENSRNOG00000011992: 65%
Entrez Gene ID: 6570
Uniprot ID: P54219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC18A1
Alternative Gene Name: CGAT, VAT1, VMAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036330: 64%, ENSRNOG00000011992: 65%
Entrez Gene ID: 6570
Uniprot ID: P54219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI |
| Documents & Links for Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) | |
| Datasheet | Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) | |
| Datasheet | Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC18A1 pAb (ATL-HPA006877 w/enhanced validation) |