Anti SLC17A4 pAb (ATL-HPA055564)

Atlas Antibodies

SKU:
ATL-HPA055564-25
  • Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 17, member 4
Gene Name: SLC17A4
Alternative Gene Name: KIAA2138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021336: 81%, ENSRNOG00000022505: 84%
Entrez Gene ID: 10050
Uniprot ID: Q9Y2C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRA
Gene Sequence YDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRA
Gene ID - Mouse ENSMUSG00000021336
Gene ID - Rat ENSRNOG00000022505
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC17A4 pAb (ATL-HPA055564)
Datasheet Anti SLC17A4 pAb (ATL-HPA055564) Datasheet (External Link)
Vendor Page Anti SLC17A4 pAb (ATL-HPA055564) at Atlas Antibodies

Documents & Links for Anti SLC17A4 pAb (ATL-HPA055564)
Datasheet Anti SLC17A4 pAb (ATL-HPA055564) Datasheet (External Link)
Vendor Page Anti SLC17A4 pAb (ATL-HPA055564)