Anti SLC16A6 pAb (ATL-HPA054459)

Atlas Antibodies

SKU: ATL-HPA054459-25

• 

Protein Description: solute carrier family 16, member 6
Gene Name: SLC16A6
Alternative Gene Name: MCT6, MCT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041920: 68%, ENSRNOG00000000245: 65%
Entrez Gene ID: 9120
Uniprot ID: O15403
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL
• Gene Sequence: PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL
• Gene ID - Mouse: ENSMUSG00000041920
• Gene ID - Rat: ENSRNOG00000000245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.