Anti SLC15A3 pAb (ATL-HPA047880)

Atlas Antibodies

SKU:
ATL-HPA047880-25
  • Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 15 (oligopeptide transporter), member 3
Gene Name: SLC15A3
Alternative Gene Name: hPTR3, PHT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024737: 68%, ENSRNOG00000021644: 66%
Entrez Gene ID: 51296
Uniprot ID: Q8IY34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Gene Sequence PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Gene ID - Mouse ENSMUSG00000024737
Gene ID - Rat ENSRNOG00000021644
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC15A3 pAb (ATL-HPA047880)
Datasheet Anti SLC15A3 pAb (ATL-HPA047880) Datasheet (External Link)
Vendor Page Anti SLC15A3 pAb (ATL-HPA047880) at Atlas Antibodies

Documents & Links for Anti SLC15A3 pAb (ATL-HPA047880)
Datasheet Anti SLC15A3 pAb (ATL-HPA047880) Datasheet (External Link)
Vendor Page Anti SLC15A3 pAb (ATL-HPA047880)