Protein Description: solute carrier family 14 member 1 (Kidd blood group)
Gene Name: SLC14A1
Alternative Gene Name: HsT1341, JK, RACH1, RACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059336: 60%,
Entrez Gene ID: 6563
Uniprot ID: Q13336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC14A1
Alternative Gene Name: HsT1341, JK, RACH1, RACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059336: 60%,
Entrez Gene ID: 6563
Uniprot ID: Q13336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MNGRSLIGGAGDARHGPVWKDPFGTKAGDAARRGIARLSLALADGSQEQE |
| Documents & Links for Anti SLC14A1 pAb (ATL-HPA077233) | |
| Datasheet | Anti SLC14A1 pAb (ATL-HPA077233) Datasheet (External Link) |
| Vendor Page | Anti SLC14A1 pAb (ATL-HPA077233) at Atlas |
| Documents & Links for Anti SLC14A1 pAb (ATL-HPA077233) | |
| Datasheet | Anti SLC14A1 pAb (ATL-HPA077233) Datasheet (External Link) |
| Vendor Page | Anti SLC14A1 pAb (ATL-HPA077233) |