Anti SLC14A1 pAb (ATL-HPA059570)

Atlas Antibodies

SKU: ATL-HPA059570-25

• 

Protein Description: solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
Gene Name: SLC14A1
Alternative Gene Name: HsT1341, JK, RACH1, RACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059336: 74%, ENSRNOG00000016753: 74%
Entrez Gene ID: 6563
Uniprot ID: Q13336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI
• Gene Sequence: GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI
• Gene ID - Mouse: ENSMUSG00000059336
• Gene ID - Rat: ENSRNOG00000016753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.