Anti SLAMF6 pAb (ATL-HPA051363)

Atlas Antibodies

SKU: ATL-HPA051363-25

• 

Protein Description: SLAM family member 6
Gene Name: SLAMF6
Alternative Gene Name: CD352, KALI, KALIb, Ly108, NTB-A, NTBA, SF2000
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015314: 50%, ENSRNOG00000038286: 50%
Entrez Gene ID: 114836
Uniprot ID: Q96DU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT
• Gene Sequence: LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT
• Gene ID - Mouse: ENSMUSG00000015314
• Gene ID - Rat: ENSRNOG00000038286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.