Anti SLA2 pAb (ATL-HPA053746)

Atlas Antibodies

SKU:
ATL-HPA053746-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Src-like-adaptor 2
Gene Name: SLA2
Alternative Gene Name: C20orf156, FLJ21992, SLAP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027636: 84%, ENSRNOG00000020337: 84%
Entrez Gene ID: 84174
Uniprot ID: Q9H6Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
Gene Sequence GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
Gene ID - Mouse ENSMUSG00000027636
Gene ID - Rat ENSRNOG00000020337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLA2 pAb (ATL-HPA053746)
Datasheet Anti SLA2 pAb (ATL-HPA053746) Datasheet (External Link)
Vendor Page Anti SLA2 pAb (ATL-HPA053746) at Atlas Antibodies

Documents & Links for Anti SLA2 pAb (ATL-HPA053746)
Datasheet Anti SLA2 pAb (ATL-HPA053746) Datasheet (External Link)
Vendor Page Anti SLA2 pAb (ATL-HPA053746)