Anti SKP2 pAb (ATL-HPA051196 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051196-100

• 
• 

Protein Description: S-phase kinase-associated protein 2, E3 ubiquitin protein ligase
Gene Name: SKP2
Alternative Gene Name: FBL1, FBXL1, p45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111328: 88%, ENSRNOG00000059059: 88%
Entrez Gene ID: 6502
Uniprot ID: Q13309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
• Gene Sequence: SLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
• Gene ID - Mouse: ENSMUSG00000111328
• Gene ID - Rat: ENSRNOG00000059059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.