Anti SKIV2L pAb (ATL-HPA054419)

Atlas Antibodies

SKU:
ATL-HPA054419-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: superkiller viralicidic activity 2-like (S. cerevisiae)
Gene Name: SKIV2L
Alternative Gene Name: 170A, DDX13, HLP, SKI2W, SKIV2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040356: 97%, ENSRNOG00000000421: 97%
Entrez Gene ID: 6499
Uniprot ID: Q15477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV
Gene Sequence TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV
Gene ID - Mouse ENSMUSG00000040356
Gene ID - Rat ENSRNOG00000000421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SKIV2L pAb (ATL-HPA054419)
Datasheet Anti SKIV2L pAb (ATL-HPA054419) Datasheet (External Link)
Vendor Page Anti SKIV2L pAb (ATL-HPA054419) at Atlas Antibodies

Documents & Links for Anti SKIV2L pAb (ATL-HPA054419)
Datasheet Anti SKIV2L pAb (ATL-HPA054419) Datasheet (External Link)
Vendor Page Anti SKIV2L pAb (ATL-HPA054419)