Anti SKA1 pAb (ATL-HPA045495)

Atlas Antibodies

SKU: ATL-HPA045495-100

• 
• 

Protein Description: spindle and kinetochore associated complex subunit 1
Gene Name: SKA1
Alternative Gene Name: C18orf24, MGC10200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036223: 70%, ENSRNOG00000015275: 76%
Entrez Gene ID: 220134
Uniprot ID: Q96BD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM
• Gene Sequence: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM
• Gene ID - Mouse: ENSMUSG00000036223
• Gene ID - Rat: ENSRNOG00000015275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.