Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054437-25
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA054437 antibody. Corresponding SIRPA RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: signal-regulatory protein alpha
Gene Name: SIRPA
Alternative Gene Name: BIT, CD172a, MFR, MYD-1, P84, PTPNS1, SHPS-1, SHPS1, SIRP, SIRP-ALPHA-1, SIRPalpha, SIRPalpha2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037902: 81%, ENSRNOG00000004763: 81%
Entrez Gene ID: 140885
Uniprot ID: P78324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Gene Sequence NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Gene ID - Mouse ENSMUSG00000037902
Gene ID - Rat ENSRNOG00000004763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation)
Datasheet Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation)
Datasheet Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation)