Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA054437-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SIRPA
Alternative Gene Name: BIT, CD172a, MFR, MYD-1, P84, PTPNS1, SHPS-1, SHPS1, SIRP, SIRP-ALPHA-1, SIRPalpha, SIRPalpha2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037902: 81%, ENSRNOG00000004763: 81%
Entrez Gene ID: 140885
Uniprot ID: P78324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK |
Gene Sequence | NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK |
Gene ID - Mouse | ENSMUSG00000037902 |
Gene ID - Rat | ENSRNOG00000004763 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) | |
Datasheet | Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) | |
Datasheet | Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SIRPA pAb (ATL-HPA054437 w/enhanced validation) |