Anti SIPA1L3 pAb (ATL-HPA045480)

Atlas Antibodies

SKU: ATL-HPA045480-25

• 
• 

Protein Description: signal-induced proliferation-associated 1 like 3
Gene Name: SIPA1L3
Alternative Gene Name: KIAA0545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030583: 87%, ENSRNOG00000020703: 85%
Entrez Gene ID: 23094
Uniprot ID: O60292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETYDMNTSEPKTEQESITPGGRPPYRSNAPWQWSGPASHNSLPASKWATPTTPGHAQSLSRPLKQTPIVPFRESQPLHSKRPVSFPETPYTVSPAGA
• Gene Sequence: ETYDMNTSEPKTEQESITPGGRPPYRSNAPWQWSGPASHNSLPASKWATPTTPGHAQSLSRPLKQTPIVPFRESQPLHSKRPVSFPETPYTVSPAGA
• Gene ID - Mouse: ENSMUSG00000030583
• Gene ID - Rat: ENSRNOG00000020703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.