Anti SIK3 pAb (ATL-HPA048161)

Atlas Antibodies

SKU:
ATL-HPA048161-25
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts. Leydig cells exhibited strong nuclear staining.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SIK family kinase 3
Gene Name: SIK3
Alternative Gene Name: FLJ12240, KIAA0999, L19, QSK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034135: 84%, ENSRNOG00000045931: 80%
Entrez Gene ID: 23387
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQEYQELFRHMNQGDAGSLAPSLGGQSMTERQALSYQNADSYHHHTSPQHLLQIRAQECVSQASSPTPPHGYAHQPALMHSESMEEDCSCEGAKDGFQD
Gene Sequence QQEYQELFRHMNQGDAGSLAPSLGGQSMTERQALSYQNADSYHHHTSPQHLLQIRAQECVSQASSPTPPHGYAHQPALMHSESMEEDCSCEGAKDGFQD
Gene ID - Mouse ENSMUSG00000034135
Gene ID - Rat ENSRNOG00000045931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SIK3 pAb (ATL-HPA048161)
Datasheet Anti SIK3 pAb (ATL-HPA048161) Datasheet (External Link)
Vendor Page Anti SIK3 pAb (ATL-HPA048161) at Atlas Antibodies

Documents & Links for Anti SIK3 pAb (ATL-HPA048161)
Datasheet Anti SIK3 pAb (ATL-HPA048161) Datasheet (External Link)
Vendor Page Anti SIK3 pAb (ATL-HPA048161)



Citations for Anti SIK3 pAb (ATL-HPA048161) – 3 Found
Tarumoto, Yusuke; Lin, Shan; Wang, Jinhua; Milazzo, Joseph P; Xu, Yali; Lu, Bin; Yang, Zhaolin; Wei, Yiliang; Polyanskaya, Sofya; Wunderlich, Mark; Gray, Nathanael S; Stegmaier, Kimberly; Vakoc, Christopher R. Salt-inducible kinase inhibition suppresses acute myeloid leukemia progression in vivo. Blood. 2020;135(1):56-70.  PubMed
Canté-Barrett, Kirsten; Meijer, Mariska T; Cordo', Valentina; Hagelaar, Rico; Yang, Wentao; Yu, Jiyang; Smits, Willem K; Nulle, Marloes E; Jansen, Joris P; Pieters, Rob; Yang, Jun J; Haigh, Jody J; Goossens, Steven; Meijerink, Jules Pp. MEF2C opposes Notch in lymphoid lineage decision and drives leukemia in the thymus. Jci Insight. 2022;7(13)  PubMed
Cheng, Tzu-Chun; Sayseng, John Oliver; Tu, Shih-Hsin; Juan, Ting-Ching; Fang, Chia-Lang; Liao, You-Cheng; Chu, Cheng-Ying; Chang, Hui-Wen; Yen, Yun; Chen, Li-Ching; Ho, Yuan-Soon. Curcumin-induced antitumor effects on triple-negative breast cancer patient-derived xenograft tumor mice through inhibiting salt-induced kinase-3 protein. Journal Of Food And Drug Analysis. 2021;29(4):622-637.  PubMed