Anti SIK3 pAb (ATL-HPA045245)

Atlas Antibodies

SKU:
ATL-HPA045245-25
  • Immunohistochemical staining of human breast shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SIK family kinase 3
Gene Name: SIK3
Alternative Gene Name: FLJ12240, KIAA0999, L19, QSK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034135: 98%, ENSRNOG00000045931: 97%
Entrez Gene ID: 23387
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQQEQHHQILQQQIQDSICPPQP
Gene Sequence STYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQQEQHHQILQQQIQDSICPPQP
Gene ID - Mouse ENSMUSG00000034135
Gene ID - Rat ENSRNOG00000045931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SIK3 pAb (ATL-HPA045245)
Datasheet Anti SIK3 pAb (ATL-HPA045245) Datasheet (External Link)
Vendor Page Anti SIK3 pAb (ATL-HPA045245) at Atlas Antibodies

Documents & Links for Anti SIK3 pAb (ATL-HPA045245)
Datasheet Anti SIK3 pAb (ATL-HPA045245) Datasheet (External Link)
Vendor Page Anti SIK3 pAb (ATL-HPA045245)



Citations for Anti SIK3 pAb (ATL-HPA045245) – 1 Found
Tarumoto, Yusuke; Lin, Shan; Wang, Jinhua; Milazzo, Joseph P; Xu, Yali; Lu, Bin; Yang, Zhaolin; Wei, Yiliang; Polyanskaya, Sofya; Wunderlich, Mark; Gray, Nathanael S; Stegmaier, Kimberly; Vakoc, Christopher R. Salt-inducible kinase inhibition suppresses acute myeloid leukemia progression in vivo. Blood. 2020;135(1):56-70.  PubMed