Anti SIGLEC11 pAb (ATL-HPA052132)
Atlas Antibodies
- SKU:
- ATL-HPA052132-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SIGLEC11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028599: 37%, ENSRNOG00000011619: 35%
Entrez Gene ID: 114132
Uniprot ID: Q96RL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK |
Gene Sequence | YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK |
Gene ID - Mouse | ENSMUSG00000028599 |
Gene ID - Rat | ENSRNOG00000011619 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SIGLEC11 pAb (ATL-HPA052132) | |
Datasheet | Anti SIGLEC11 pAb (ATL-HPA052132) Datasheet (External Link) |
Vendor Page | Anti SIGLEC11 pAb (ATL-HPA052132) at Atlas Antibodies |
Documents & Links for Anti SIGLEC11 pAb (ATL-HPA052132) | |
Datasheet | Anti SIGLEC11 pAb (ATL-HPA052132) Datasheet (External Link) |
Vendor Page | Anti SIGLEC11 pAb (ATL-HPA052132) |