Anti SIGLEC11 pAb (ATL-HPA052132)

Atlas Antibodies

SKU: ATL-HPA052132-25

• 

Protein Description: sialic acid binding Ig like lectin 11
Gene Name: SIGLEC11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028599: 37%, ENSRNOG00000011619: 35%
Entrez Gene ID: 114132
Uniprot ID: Q96RL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
• Gene Sequence: YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
• Gene ID - Mouse: ENSMUSG00000028599
• Gene ID - Rat: ENSRNOG00000011619
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.