Anti SIAH3 pAb (ATL-HPA060576)
Atlas Antibodies
- SKU:
- ATL-HPA060576-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: siah E3 ubiquitin protein ligase family member 3
Gene Name: SIAH3
Alternative Gene Name: FLJ39203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091722: 84%, ENSRNOG00000043061: 81%
Entrez Gene ID: 283514
Uniprot ID: Q8IW03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SIAH3
Alternative Gene Name: FLJ39203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091722: 84%, ENSRNOG00000043061: 81%
Entrez Gene ID: 283514
Uniprot ID: Q8IW03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS |
Gene Sequence | SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS |
Gene ID - Mouse | ENSMUSG00000091722 |
Gene ID - Rat | ENSRNOG00000043061 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SIAH3 pAb (ATL-HPA060576) | |
Datasheet | Anti SIAH3 pAb (ATL-HPA060576) Datasheet (External Link) |
Vendor Page | Anti SIAH3 pAb (ATL-HPA060576) at Atlas Antibodies |
Documents & Links for Anti SIAH3 pAb (ATL-HPA060576) | |
Datasheet | Anti SIAH3 pAb (ATL-HPA060576) Datasheet (External Link) |
Vendor Page | Anti SIAH3 pAb (ATL-HPA060576) |