Anti SIAH3 pAb (ATL-HPA060576)

Atlas Antibodies

SKU: ATL-HPA060576-25

• 

Product Description

Protein Description: siah E3 ubiquitin protein ligase family member 3
Gene Name: SIAH3
Alternative Gene Name: FLJ39203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091722: 84%, ENSRNOG00000043061: 81%
Entrez Gene ID: 283514
Uniprot ID: Q8IW03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS
• Gene Sequence: SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS
• Gene ID - Mouse: ENSMUSG00000091722
• Gene ID - Rat: ENSRNOG00000043061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links