Anti SHROOM2 pAb (ATL-HPA051646)

Atlas Antibodies

SKU:
ATL-HPA051646-25
  • Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: shroom family member 2
Gene Name: SHROOM2
Alternative Gene Name: APXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045180: 86%, ENSRNOG00000024322: 89%
Entrez Gene ID: 357
Uniprot ID: Q13796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAEPPALPHGLEKDQIKTLSTSEQFYS
Gene Sequence PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAEPPALPHGLEKDQIKTLSTSEQFYS
Gene ID - Mouse ENSMUSG00000045180
Gene ID - Rat ENSRNOG00000024322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SHROOM2 pAb (ATL-HPA051646)
Datasheet Anti SHROOM2 pAb (ATL-HPA051646) Datasheet (External Link)
Vendor Page Anti SHROOM2 pAb (ATL-HPA051646) at Atlas Antibodies

Documents & Links for Anti SHROOM2 pAb (ATL-HPA051646)
Datasheet Anti SHROOM2 pAb (ATL-HPA051646) Datasheet (External Link)
Vendor Page Anti SHROOM2 pAb (ATL-HPA051646)