Anti SHOX pAb (ATL-HPA060931)

Atlas Antibodies

SKU:
ATL-HPA060931-25
  • Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: short stature homeobox
Gene Name: SHOX
Alternative Gene Name: GCFX, PHOG, SHOXY, SS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024081: 27%, ENSRNOG00000000604: 30%
Entrez Gene ID: 6473
Uniprot ID: O15266
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVK
Gene Sequence GTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVK
Gene ID - Mouse ENSMUSG00000024081
Gene ID - Rat ENSRNOG00000000604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SHOX pAb (ATL-HPA060931)
Datasheet Anti SHOX pAb (ATL-HPA060931) Datasheet (External Link)
Vendor Page Anti SHOX pAb (ATL-HPA060931) at Atlas Antibodies

Documents & Links for Anti SHOX pAb (ATL-HPA060931)
Datasheet Anti SHOX pAb (ATL-HPA060931) Datasheet (External Link)
Vendor Page Anti SHOX pAb (ATL-HPA060931)