Anti SHISA4 pAb (ATL-HPA061273)
Atlas Antibodies
- SKU:
- ATL-HPA061273-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: shisa family member 4
Gene Name: SHISA4
Alternative Gene Name: C1orf40, hShisa4, TMEM58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041889: 96%, ENSRNOG00000007369: 96%
Entrez Gene ID: 149345
Uniprot ID: Q96DD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SHISA4
Alternative Gene Name: C1orf40, hShisa4, TMEM58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041889: 96%, ENSRNOG00000007369: 96%
Entrez Gene ID: 149345
Uniprot ID: Q96DD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCL |
Gene Sequence | DCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCL |
Gene ID - Mouse | ENSMUSG00000041889 |
Gene ID - Rat | ENSRNOG00000007369 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SHISA4 pAb (ATL-HPA061273) | |
Datasheet | Anti SHISA4 pAb (ATL-HPA061273) Datasheet (External Link) |
Vendor Page | Anti SHISA4 pAb (ATL-HPA061273) at Atlas Antibodies |
Documents & Links for Anti SHISA4 pAb (ATL-HPA061273) | |
Datasheet | Anti SHISA4 pAb (ATL-HPA061273) Datasheet (External Link) |
Vendor Page | Anti SHISA4 pAb (ATL-HPA061273) |