Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA064821-25

• 

Protein Description: SHC SH2-domain binding protein 1-like
Gene Name: SHCBP1L
Alternative Gene Name: C1orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042708: 86%, ENSRNOG00000002691: 86%
Entrez Gene ID: 81626
Uniprot ID: Q9BZQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLRGVNMKVLPAPKLKMTNNHIYSNKGYGVSILQPMEQFFIVAEEALNKRASSGDKKDDKMLFKVMQNLNLEMNNNKI
• Gene Sequence: TLRGVNMKVLPAPKLKMTNNHIYSNKGYGVSILQPMEQFFIVAEEALNKRASSGDKKDDKMLFKVMQNLNLEMNNNKI
• Gene ID - Mouse: ENSMUSG00000042708
• Gene ID - Rat: ENSRNOG00000002691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.