Protein Description: SHC SH2-domain binding protein 1-like
Gene Name: SHCBP1L
Alternative Gene Name: C1orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042708: 86%, ENSRNOG00000002691: 86%
Entrez Gene ID: 81626
Uniprot ID: Q9BZQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SHCBP1L
Alternative Gene Name: C1orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042708: 86%, ENSRNOG00000002691: 86%
Entrez Gene ID: 81626
Uniprot ID: Q9BZQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TLRGVNMKVLPAPKLKMTNNHIYSNKGYGVSILQPMEQFFIVAEEALNKRASSGDKKDDKMLFKVMQNLNLEMNNNKI |
Documents & Links for Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation) | |
Datasheet | Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation) at Atlas |
Documents & Links for Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation) | |
Datasheet | Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SHCBP1L pAb (ATL-HPA064821 w/enhanced validation) |