Anti SHB pAb (ATL-HPA052108)

Atlas Antibodies

SKU:
ATL-HPA052108-25
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Src homology 2 domain containing adaptor protein B
Gene Name: SHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044813: 100%, ENSRNOG00000011503: 100%
Entrez Gene ID: 6461
Uniprot ID: Q15464
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD
Gene Sequence WEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD
Gene ID - Mouse ENSMUSG00000044813
Gene ID - Rat ENSRNOG00000011503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SHB pAb (ATL-HPA052108)
Datasheet Anti SHB pAb (ATL-HPA052108) Datasheet (External Link)
Vendor Page Anti SHB pAb (ATL-HPA052108) at Atlas Antibodies

Documents & Links for Anti SHB pAb (ATL-HPA052108)
Datasheet Anti SHB pAb (ATL-HPA052108) Datasheet (External Link)
Vendor Page Anti SHB pAb (ATL-HPA052108)