Anti SHB pAb (ATL-HPA049911)

Atlas Antibodies

SKU: ATL-HPA049911-25

• 

Protein Description: Src homology 2 domain containing adaptor protein B
Gene Name: SHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044813: 86%, ENSRNOG00000011503: 89%
Entrez Gene ID: 6461
Uniprot ID: Q15464
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM
• Gene Sequence: TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM
• Gene ID - Mouse: ENSMUSG00000044813
• Gene ID - Rat: ENSRNOG00000011503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.