Anti SH3RF3 pAb (ATL-HPA048444)

Atlas Antibodies

SKU: ATL-HPA048444-25

• 
• 

Protein Description: SH3 domain containing ring finger 3
Gene Name: SH3RF3
Alternative Gene Name: FLJ00204, POSH2, SH3MD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037990: 84%, ENSRNOG00000046791: 84%
Entrez Gene ID: 344558
Uniprot ID: Q8TEJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LISSSDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELE
• Gene Sequence: LISSSDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELE
• Gene ID - Mouse: ENSMUSG00000037990
• Gene ID - Rat: ENSRNOG00000046791
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.