Protein Description: SH3 domain containing ring finger 1
Gene Name: SH3RF1
Alternative Gene Name: KIAA1494, POSH, RNF142, SH3MD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031642: 91%, ENSRNOG00000010358: 94%
Entrez Gene ID: 57630
Uniprot ID: Q7Z6J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SH3RF1
Alternative Gene Name: KIAA1494, POSH, RNF142, SH3MD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031642: 91%, ENSRNOG00000010358: 94%
Entrez Gene ID: 57630
Uniprot ID: Q7Z6J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH |
| Documents & Links for Anti SH3RF1 pAb (ATL-HPA074783) | |
| Datasheet | Anti SH3RF1 pAb (ATL-HPA074783) Datasheet (External Link) |
| Vendor Page | Anti SH3RF1 pAb (ATL-HPA074783) at Atlas |
| Documents & Links for Anti SH3RF1 pAb (ATL-HPA074783) | |
| Datasheet | Anti SH3RF1 pAb (ATL-HPA074783) Datasheet (External Link) |
| Vendor Page | Anti SH3RF1 pAb (ATL-HPA074783) |