Anti SH3RF1 pAb (ATL-HPA074783)

Atlas Antibodies

SKU: ATL-HPA074783-25

• 

Protein Description: SH3 domain containing ring finger 1
Gene Name: SH3RF1
Alternative Gene Name: KIAA1494, POSH, RNF142, SH3MD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031642: 91%, ENSRNOG00000010358: 94%
Entrez Gene ID: 57630
Uniprot ID: Q7Z6J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH
• Gene Sequence: AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH
• Gene ID - Mouse: ENSMUSG00000031642
• Gene ID - Rat: ENSRNOG00000010358
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.