Anti SH3D19 pAb (ATL-HPA058562)
Atlas Antibodies
- SKU:
- ATL-HPA058562-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: SH3 domain containing 19
Gene Name: SH3D19
Alternative Gene Name: DKFZp434D0215, EBP, EVE1, Kryn, SH3P19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028082: 82%, ENSRNOG00000011752: 84%
Entrez Gene ID: 152503
Uniprot ID: Q5HYK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SH3D19
Alternative Gene Name: DKFZp434D0215, EBP, EVE1, Kryn, SH3P19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028082: 82%, ENSRNOG00000011752: 84%
Entrez Gene ID: 152503
Uniprot ID: Q5HYK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN |
Gene Sequence | LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN |
Gene ID - Mouse | ENSMUSG00000028082 |
Gene ID - Rat | ENSRNOG00000011752 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SH3D19 pAb (ATL-HPA058562) | |
Datasheet | Anti SH3D19 pAb (ATL-HPA058562) Datasheet (External Link) |
Vendor Page | Anti SH3D19 pAb (ATL-HPA058562) at Atlas Antibodies |
Documents & Links for Anti SH3D19 pAb (ATL-HPA058562) | |
Datasheet | Anti SH3D19 pAb (ATL-HPA058562) Datasheet (External Link) |
Vendor Page | Anti SH3D19 pAb (ATL-HPA058562) |