Anti SH2D6 pAb (ATL-HPA053873 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053873-25

• 
• 

Protein Description: SH2 domain containing 6
Gene Name: SH2D6
Alternative Gene Name: FLJ35993
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052631: 86%, ENSRNOG00000013605: 87%
Entrez Gene ID: 284948
Uniprot ID: Q7Z4S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHFMWHPLPLVDRHSGSRE
• Gene Sequence: HGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHFMWHPLPLVDRHSGSRE
• Gene ID - Mouse: ENSMUSG00000052631
• Gene ID - Rat: ENSRNOG00000013605
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.