Anti SH2B2 pAb (ATL-HPA051131)

Atlas Antibodies

SKU:
ATL-HPA051131-25
  • Immunohistochemical staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SH2B adaptor protein 2
Gene Name: SH2B2
Alternative Gene Name: APS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005057: 97%, ENSRNOG00000001425: 97%
Entrez Gene ID: 10603
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
Gene Sequence RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
Gene ID - Mouse ENSMUSG00000005057
Gene ID - Rat ENSRNOG00000001425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SH2B2 pAb (ATL-HPA051131)
Datasheet Anti SH2B2 pAb (ATL-HPA051131) Datasheet (External Link)
Vendor Page Anti SH2B2 pAb (ATL-HPA051131) at Atlas Antibodies

Documents & Links for Anti SH2B2 pAb (ATL-HPA051131)
Datasheet Anti SH2B2 pAb (ATL-HPA051131) Datasheet (External Link)
Vendor Page Anti SH2B2 pAb (ATL-HPA051131)