Anti SH2B2 pAb (ATL-HPA051131)
Atlas Antibodies
- SKU:
- ATL-HPA051131-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SH2B2
Alternative Gene Name: APS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005057: 97%, ENSRNOG00000001425: 97%
Entrez Gene ID: 10603
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD |
Gene Sequence | RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD |
Gene ID - Mouse | ENSMUSG00000005057 |
Gene ID - Rat | ENSRNOG00000001425 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SH2B2 pAb (ATL-HPA051131) | |
Datasheet | Anti SH2B2 pAb (ATL-HPA051131) Datasheet (External Link) |
Vendor Page | Anti SH2B2 pAb (ATL-HPA051131) at Atlas Antibodies |
Documents & Links for Anti SH2B2 pAb (ATL-HPA051131) | |
Datasheet | Anti SH2B2 pAb (ATL-HPA051131) Datasheet (External Link) |
Vendor Page | Anti SH2B2 pAb (ATL-HPA051131) |