Anti SGTA pAb (ATL-HPA056309)

Atlas Antibodies

SKU: ATL-HPA056309-25

• 
• 
• 

Protein Description: small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha
Gene Name: SGTA
Alternative Gene Name: SGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004937: 88%, ENSRNOG00000019891: 88%
Entrez Gene ID: 6449
Uniprot ID: O43765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAE
• Gene Sequence: IQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAE
• Gene ID - Mouse: ENSMUSG00000004937
• Gene ID - Rat: ENSRNOG00000019891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.