Anti SGSM3 pAb (ATL-HPA048980)

Atlas Antibodies

SKU:
ATL-HPA048980-25
  • Immunohistochemical staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: small G protein signaling modulator 3
Gene Name: SGSM3
Alternative Gene Name: DJ1042K10.2, RabGAP-5, RABGAP5, RUSC3, RUTBC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042303: 85%, ENSRNOG00000018745: 82%
Entrez Gene ID: 27352
Uniprot ID: Q96HU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLP
Gene Sequence PFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLP
Gene ID - Mouse ENSMUSG00000042303
Gene ID - Rat ENSRNOG00000018745
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SGSM3 pAb (ATL-HPA048980)
Datasheet Anti SGSM3 pAb (ATL-HPA048980) Datasheet (External Link)
Vendor Page Anti SGSM3 pAb (ATL-HPA048980) at Atlas Antibodies

Documents & Links for Anti SGSM3 pAb (ATL-HPA048980)
Datasheet Anti SGSM3 pAb (ATL-HPA048980) Datasheet (External Link)
Vendor Page Anti SGSM3 pAb (ATL-HPA048980)