Anti SGMS1 pAb (ATL-HPA045191)
Atlas Antibodies
- SKU:
- ATL-HPA045191-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SGMS1
Alternative Gene Name: MGC17342, MOB, SMS1, TMEM23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040451: 94%, ENSRNOG00000012536: 95%
Entrez Gene ID: 259230
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM |
Gene Sequence | ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM |
Gene ID - Mouse | ENSMUSG00000040451 |
Gene ID - Rat | ENSRNOG00000012536 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SGMS1 pAb (ATL-HPA045191) | |
Datasheet | Anti SGMS1 pAb (ATL-HPA045191) Datasheet (External Link) |
Vendor Page | Anti SGMS1 pAb (ATL-HPA045191) at Atlas Antibodies |
Documents & Links for Anti SGMS1 pAb (ATL-HPA045191) | |
Datasheet | Anti SGMS1 pAb (ATL-HPA045191) Datasheet (External Link) |
Vendor Page | Anti SGMS1 pAb (ATL-HPA045191) |
Citations for Anti SGMS1 pAb (ATL-HPA045191) – 1 Found |
Mori, Yoshio; Sakata, Masafumi; Sakai, Shota; Okamoto, Toru; Nakatsu, Yuichiro; Taguwa, Shuhei; Otsuki, Noriyuki; Maeda, Yusuke; Hanada, Kentaro; Matsuura, Yoshiharu; Takeda, Makoto. Membrane Sphingomyelin in Host Cells Is Essential for Nucleocapsid Penetration into the Cytoplasm after Hemifusion during Rubella Virus Entry. Mbio. 2022;13(6):e0169822. PubMed |