Anti SGMS1 pAb (ATL-HPA045191)

Atlas Antibodies

SKU:
ATL-HPA045191-25
  • Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
  • Western blot analysis in human lung tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: sphingomyelin synthase 1
Gene Name: SGMS1
Alternative Gene Name: MGC17342, MOB, SMS1, TMEM23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040451: 94%, ENSRNOG00000012536: 95%
Entrez Gene ID: 259230
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM
Gene Sequence ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM
Gene ID - Mouse ENSMUSG00000040451
Gene ID - Rat ENSRNOG00000012536
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SGMS1 pAb (ATL-HPA045191)
Datasheet Anti SGMS1 pAb (ATL-HPA045191) Datasheet (External Link)
Vendor Page Anti SGMS1 pAb (ATL-HPA045191) at Atlas Antibodies

Documents & Links for Anti SGMS1 pAb (ATL-HPA045191)
Datasheet Anti SGMS1 pAb (ATL-HPA045191) Datasheet (External Link)
Vendor Page Anti SGMS1 pAb (ATL-HPA045191)



Citations for Anti SGMS1 pAb (ATL-HPA045191) – 1 Found
Mori, Yoshio; Sakata, Masafumi; Sakai, Shota; Okamoto, Toru; Nakatsu, Yuichiro; Taguwa, Shuhei; Otsuki, Noriyuki; Maeda, Yusuke; Hanada, Kentaro; Matsuura, Yoshiharu; Takeda, Makoto. Membrane Sphingomyelin in Host Cells Is Essential for Nucleocapsid Penetration into the Cytoplasm after Hemifusion during Rubella Virus Entry. Mbio. 2022;13(6):e0169822.  PubMed