Anti SGK494 pAb (ATL-HPA046590)

Atlas Antibodies

SKU:
ATL-HPA046590-100
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: uncharacterized serine/threonine-protein kinase SgK494
Gene Name: SGK494
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037593: 64%, ENSRNOG00000037214: 69%
Entrez Gene ID: 124923
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLP
Gene Sequence MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLP
Gene ID - Mouse ENSMUSG00000037593
Gene ID - Rat ENSRNOG00000037214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SGK494 pAb (ATL-HPA046590)
Datasheet Anti SGK494 pAb (ATL-HPA046590) Datasheet (External Link)
Vendor Page Anti SGK494 pAb (ATL-HPA046590) at Atlas Antibodies

Documents & Links for Anti SGK494 pAb (ATL-HPA046590)
Datasheet Anti SGK494 pAb (ATL-HPA046590) Datasheet (External Link)
Vendor Page Anti SGK494 pAb (ATL-HPA046590)