Anti SGF29 pAb (ATL-HPA053608)

Atlas Antibodies

SKU: ATL-HPA053608-25

• 

Protein Description: SAGA complex associated factor 29
Gene Name: SGF29
Alternative Gene Name: CCDC101, FLJ32446, TDRD29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030714: 97%, ENSRNOG00000019245: 97%
Entrez Gene ID: 112869
Uniprot ID: Q96ES7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
• Gene Sequence: RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
• Gene ID - Mouse: ENSMUSG00000030714
• Gene ID - Rat: ENSRNOG00000019245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.