Anti SFTPA1 pAb (ATL-HPA045752)

Atlas Antibodies

Catalog No.:
ATL-HPA045752-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: surfactant protein A1
Gene Name: SFTPA1
Alternative Gene Name: COLEC4, SFTP1, SP-A, SP-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021789: 74%, ENSRNOG00000011438: 70%
Entrez Gene ID: 653509
Uniprot ID: Q8IWL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRG
Gene Sequence IAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRG
Gene ID - Mouse ENSMUSG00000021789
Gene ID - Rat ENSRNOG00000011438
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFTPA1 pAb (ATL-HPA045752)
Datasheet Anti SFTPA1 pAb (ATL-HPA045752) Datasheet (External Link)
Vendor Page Anti SFTPA1 pAb (ATL-HPA045752) at Atlas Antibodies

Documents & Links for Anti SFTPA1 pAb (ATL-HPA045752)
Datasheet Anti SFTPA1 pAb (ATL-HPA045752) Datasheet (External Link)
Vendor Page Anti SFTPA1 pAb (ATL-HPA045752)