Anti SFPQ pAb (ATL-HPA054689 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054689-25

• 
• 
• 

Protein Description: splicing factor proline/glutamine-rich
Gene Name: SFPQ
Alternative Gene Name: PPP1R140, PSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028820: 98%, ENSRNOG00000058461: 98%
Entrez Gene ID: 6421
Uniprot ID: P23246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGI
• Gene Sequence: EEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGI
• Gene ID - Mouse: ENSMUSG00000028820
• Gene ID - Rat: ENSRNOG00000058461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.