Anti SF3B2 pAb (ATL-HPA045028)

Atlas Antibodies

SKU: ATL-HPA045028-100

• 
• 
• 

Protein Description: splicing factor 3b, subunit 2, 145kDa
Gene Name: SF3B2
Alternative Gene Name: Cus1, SAP145, SF3b1, SF3b145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024853: 100%, ENSRNOG00000020412: 100%
Entrez Gene ID: 10992
Uniprot ID: Q13435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
• Gene Sequence: MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
• Gene ID - Mouse: ENSMUSG00000024853
• Gene ID - Rat: ENSRNOG00000020412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.