Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049439-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-SF3A2 antibody HPA049439 (A) shows similar protein distribution across tissues to independent antibody HPA042843 (B).
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
  • Western blot analysis using Anti-SF3A2 antibody HPA049439 (A) shows similar pattern to independent antibody HPA042843 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: splicing factor 3a, subunit 2, 66kDa
Gene Name: SF3A2
Alternative Gene Name: Prp11, PRPF11, SAP62, SF3a66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020211: 100%, ENSRNOG00000019349: 100%
Entrez Gene ID: 8175
Uniprot ID: Q15428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
Gene Sequence SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
Gene ID - Mouse ENSMUSG00000020211
Gene ID - Rat ENSRNOG00000019349
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation)
Datasheet Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation)
Datasheet Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation)