Anti SETMAR pAb (ATL-HPA057999)

Atlas Antibodies

SKU: ATL-HPA057999-25

• 
• 

Protein Description: SET domain and mariner transposase fusion gene
Gene Name: SETMAR
Alternative Gene Name: metnase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034639: 42%, ENSRNOG00000006806: 47%
Entrez Gene ID: 6419
Uniprot ID: Q53H47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL
• Gene Sequence: ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL
• Gene ID - Mouse: ENSMUSG00000034639
• Gene ID - Rat: ENSRNOG00000006806
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.