Anti SETDB1 pAb (ATL-HPA058484)

Atlas Antibodies

SKU:
ATL-HPA058484-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: SET domain, bifurcated 1
Gene Name: SETDB1
Alternative Gene Name: ESET, KG1T, KIAA0067, KMT1E, TDRD21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015697: 95%, ENSRNOG00000021143: 95%
Entrez Gene ID: 9869
Uniprot ID: Q15047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY
Gene Sequence SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY
Gene ID - Mouse ENSMUSG00000015697
Gene ID - Rat ENSRNOG00000021143
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SETDB1 pAb (ATL-HPA058484)
Datasheet Anti SETDB1 pAb (ATL-HPA058484) Datasheet (External Link)
Vendor Page Anti SETDB1 pAb (ATL-HPA058484) at Atlas Antibodies

Documents & Links for Anti SETDB1 pAb (ATL-HPA058484)
Datasheet Anti SETDB1 pAb (ATL-HPA058484) Datasheet (External Link)
Vendor Page Anti SETDB1 pAb (ATL-HPA058484)